missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209572

Invitrogen™ Human STT3A (aa 600-656) Control Fragment Recombinant Protein

Product Code. 30209572
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209572

Brand: Invitrogen™ RP95124

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56550 (PA5-56550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P46977
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3703
Name Human STT3A (aa 600-656) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408947; B5; BB081708; dolichyl-diphosphooligosaccharide protein glycotransferase; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; Integral membrane protein 1; integral transmembrane protein 1; intergral membrane protein 1; Itm1; MGC9042; Oligosaccharyl transferase subunit STT3A; RGD1565793; STT3, subunit of the oligosaccharyltransferase complex, homolog A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); STT3A; STT3-A; STT3A, catalytic subunit of the oligosaccharyltransferase complex; STT3A, cataylic subunit of the oligosaccharyltransferase complex; STT3A, subunit of the oligosaccharyltransferase complex (catalytic); TMC; transmembrane conserved; transmembrane protein TMC
Common Name STT3A
Gene Symbol STT3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VRIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.