missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194096

Invitrogen™ Human TAB2 (aa 232-301) Control Fragment Recombinant Protein

Product Code. 30194096
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194096

Brand: Invitrogen™ RP108562

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111657 (PA5-111657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAB2 is an activator of MAP3K7/TAK1, which is required for the IL-1 induced activation NF-kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serves as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKL through the activation of the receptor activator of NF-kappaB (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. Recent experiments have shown that TAB2 and the related protein TAB3 constitutively interact with the autophagy mediator Beclin-1; upon induction of autophagy, these proteins dissociate from Beclin-1 and bind TAK1. Overexpression of TAB2 and TAB3 inhibit autophagy, while their depletion triggers it, suggesting that TAB2 and TAB3 act as a control point for autophagy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYJ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23118
Name Human TAB2 (aa 232-301) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110030N06Rik; A530078N03Rik; CHTD2; FLJ21885; KIAA0733; MAP3K7IP2; mitogen activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7 interacting protein 2; mitogen-activated protein kinase kinase kinase 7-interacting protein 2; mKIAA0733; OTTHUMP00000017388; Tab2; TAB-2; Tak1 binding protein 2; TAK1-binding protein 2; TGF-beta activated kinase 1 (MAP3K7) binding protein 2; TGF-beta activated kinase 1/MAP3K7 binding protein 2; TGF-beta-activated kinase 1 and MAP3K7-binding protein 2; TGF-beta-activated kinase 1-binding protein 2
Common Name TAB2
Gene Symbol Tab2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.