missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TADA2L (aa 1-67) Control Fragment Recombinant Protein

Product Code. 30209421
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209421

Brand: Invitrogen™ RP108086

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67425 (PA5-67425. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TADA2L (transcriptional adapter 2-like), also known as TADA2A (transcriptional adapter 2-alpha) or ADA2-like protein, is a 443 amino acid nuclear protein that exists as 2 alternatively spliced isoforms. While most abundantly expressed in testis, TADA2L is present in all tissues. TADA2L contains one SANT domain and one SWIRM domain, and interacts with GCN5 and GR (NR3C1). Its ability to bind double-stranded DNA allows TADA2L to play a role in chromatin remodeling. Although it makes up part of the PCAF complex, TADA2L is also a component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. The gene that encodes TADA2L contains 71,408 bases and maps to human chromosome 17q12. Chromosome 7 houses over 1,000 genes, comprises nearly 5% of the human genome and has been linked to osteogenesis imperfecta, Pendred syndrome, lissencephaly, citrullinemia and Shwachman-Diamond syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75478
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6871
Name Human TADA2L (aa 1-67) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ADA2; ADA2A; ADA2-like protein; AV319371; D030022J10Rik; hADA2; KL04P; TADA2A; TADA2L; transcriptional adapter 2-alpha; Transcriptional adapter 2-like; transcriptional adaptor 2 alpha; transcriptional adaptor 2 A
Common Name TADA2L
Gene Symbol TADA2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.