missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TANK (aa 7-90) Control Fragment Recombinant Protein

Product Code. 30196252
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196252

Brand: Invitrogen™ RP102779

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TANK was initially identified as a novel TRAF-interacting protein that regulated TRAF-mediated signal transduction. Specifically, ligand binding by surface receptors in the tumor necrosis factor (TNF) receptor and Toll/interleukin-1 (IL-1) receptor families lead to the formation of a TRAF/TANK complex that mediates the activation of the transcription factor NF-kappa-B. This activation of NF-kappa-B occurs through an association with the kinases IKK-iota and TBK1. More recently, it was shown that these proteins can then form a complex with NEMO, a protein that regulates the activity of the Ikappa-B complex. This suggests that in addition to the possibility that TBK1 and IKK-iota activate the IKKs, the association with the IKK complex may help these kinases modulate other functions, such as the transactivation potential of NF-kappa-B proteins. At least two isoforms of TANK are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92844
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10010
Name Human TANK (aa 7-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C86182; E430026L09Rik; ITRAF; I-TRAF; LOW QUALITY PROTEIN: TRAF family member-associated NF-kappa-B activator; OTTHUMP00000200694; OTTHUMP00000200695; OTTHUMP00000200696; OTTHUMP00000200698; OTTHUMP00000200700; OTTHUMP00000200703; OTTHUMP00000200704; TANK; TANK-like protein; TRAF family member associated NFKB activator; TRAF family member-associated Nf-kappa B activator; TRAF family member-associated NF-kappa-B activator; TRAF family member-associated NFKB activator; TRAF interacting protein TANK; TRAF2; TRAF-interacting protein; zgc:153048
Common Name TANK
Gene Symbol Tank
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.