missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204683

Invitrogen™ Human TCFL5 (aa 341-418) Control Fragment Recombinant Protein

Produktkode 30204683
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denne vare kan ikke returneres. Se returpolitik

Produktkode 30204683

missing translation for 'mfr': Invitrogen™ RP101724

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84246 (PA5-84246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q9UL49
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10732
Name Human TCFL5 (aa 341-418) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AV260129; bHLHe82; CHA; Cha transcription factor; E2BP1; E2BP-1; factor in the germline beta; FIG beta; Figlb; HPV-16 E2-binding protein 1; LOW QUALITY PROTEIN: transcription factor-like 5 protein; MGC46135; RGD1305899; SOSF1; TCFL5; transcription factor like 5; transcription factor-like 5 (basic helix-loop-helix); transcription factor-like 5 protein
Common Name TCFL5
Gene Symbol TCFL5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.