missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205610

Invitrogen™ Human TIMP1 (aa 128-200) Control Fragment Recombinant Protein

Product Code. 30205610
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205610

Brand: Invitrogen™ RP103156

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIMP1 (metalloproteinase inhibitor 1) is a metalloproteinase inhibitor that functions by forms one-to-one complexes with target metallproteinases, such as collagenases, and irreversible inactivates them by binding to their catalytic zinc cofactor. TIMP1 acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP14, and MMP16. It also functions as a growth factor that regulates cell differenation, migration, and cell death. TIMP1 activates cellular signaling cascades via CD63 and ITGB1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01033
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7076
Name Human TIMP1 (aa 128-200) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CLGI; collagenase inhibitor; Collagenase inhibitor 16C8 fibroblast; EG-1; Embryogenin-1; EPA; EPO; erythroid potentiating activity; erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Metalloproteinase inhibitor; metalloproteinase inhibitor 1; metalloproteinase tissue inhibitor; metalloproteinase tissue inhibitor 1; MMP inhibitor; RP1-230G1.3; Timp; TIMP 1; TIMP metallopeptidase inhibitor 1; TIMP1; TIMP-1; TIMP-1 protein; tissue inhibitor of matrix metalloproteinase-1; tissue inhibitor of metal proteinases; tissue inhibitor of metallopeptidase 1; tissue inhibitor of metalloproteinase; tissue inhibitor of metalloproteinase 1; tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases; tissue inhibitor of metalloproteinases 1; TPA-induced protein; TPA-S1
Common Name TIMP1
Gene Symbol TIMP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.