missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196700

Invitrogen™ Human TMEM38A (aa 230-293) Control Fragment Recombinant Protein

Product Code. 30196700
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196700

Brand: Invitrogen™ RP100827

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62194 (PA5-62194. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM38A and TMEM38B are two recently identified trimeric intracellular cation (TRIC) channel subtypes. TMEM38A is preferentially expressed in excitable tissues such as striated muscle and brain and localizes to the sarcoplasmic reticulum (SR) in muscle tissues. Mice deficient in both TMEM38A and TMEM38B suffer embryonic cardiac failure; the cardiac myocytes display severe dysfunction in SR Ca2+ handling, weakened Ca2+ release, and reduced K+ permeability indicating that the TRIC cation channels are likely to act as counter-ion channels that function in synchronization with Ca2+ release from intracellular stores. Other experiments have shown that TMEM38A and TMEM38B can act with junctophilin proteins to support efficient ryanodine receptor-mediated Ca2+ release in muscle cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H6F2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79041
Name Human TMEM38A (aa 230-293) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110001E17Rik; 27 kDa sarcoplasmic reticulum protein; AI413399; mg33a; Mitsugumin33A; Mitsugumin-33 A; RGD1307901; sarcoplasmic reticulum protein 27; SPR-27; Srp-27; TMEM38A; tmem38a {ECO:0000250; Transmembrane protein 38 A; TRICA; TRIC-A; trimeric intracellular cation channel type A; UniProtKB:Q3TMP8}
Common Name TMEM38A
Gene Symbol Tmem38a
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.