missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195533

Invitrogen™ Human TOP2A (aa 1215-1311) Control Fragment Recombinant Protein

Product Code. 30195533
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195533

Brand: Invitrogen™ RP88762

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110925 (PA5-110925. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Topo II alpha plays important roles in synthesis and transcription of DNA as well as chromosomal segregation during mitosis. It is reported to be a sensitive and specific marker of late S-, G2 and M-phases in transformed and developmentally regulated normal cellsTopo II alpha is also implicated in drug resistance of tumor cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11388
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7153
Name Human TOP2A (aa 1215-1311) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DNA gyrase; DNA topoisomerase (ATP-hydrolyzing); DNA topoisomerase 2-alpha; DNA topoisomerase 2-alpha-like protein; DNA Topoisomerase II alpha; DNA topoisomerase II, 170 kD; DNA topoisomerase II, alpha isozyme; EC 5.99.1.3; OTTHUMP00000207108; P11388-1; TOP2; Top-2; Top2a; TOPOII; topoisomerase (DNA) 2 alpha; topoisomerase (DNA) II alpha; topoisomerase (DNA) II alpha 170 kDa; topoisomerase ii alpha; topoisomersae II; TP2A
Common Name TOP2A
Gene Symbol TOP2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.