missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212256

Invitrogen™ Human TRAPPC10 (aa 838-968) Control Fragment Recombinant Protein

Product Code. 30212256
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212256

Brand: Invitrogen™ RP104221

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62189 (PA5-62189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRAPPC10, also known as TMEM1 (transmembrane protein 1), EHOC1 (epilepsy holoprosencephaly candidate 1 protein) or GT334, is a widely expressed 1,259 amino acid protein that may function in vesicular transport. Despite its name, TRAPPC10 does not contain transmembrane domains. It is the human ortholog of the yeast Trs130 protein and its structure and function appears to be conserved. Localizing to the cis-Golgi apparatus, TRAPPC10 is believed to be involved in transport from the endoplasmic reticulum (ER) to the Golgi functioning as a component of the multisubunit transport protein particle (TRAPP) complex. Mutations in the gene encoding TRAPPC10 may be involved in autoimmune polyglandular disease type 1 or Unverricht-Lundborg disease, an autosomal recessive type of progressive myoclonic epilepsy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48553
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7109
Name Human TRAPPC10 (aa 838-968) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B230307C21Rik; EHOC1; EHOC-1; epilepsy holoprosencephaly candidate 1 protein; epilepsy holoprosencephaly candidate-1 protein; Gm870; GT334; Protein GT334; TMEM1; trafficking protein particle complex 10; trafficking protein particle complex subunit 10; trafficking protein particle complex subunit 10; LOW QUALITY PROTEIN: trafficking protein particle complex subunit 10; trafficking protein particle complex subunit 130; trafficking protein particle complex subunit TMEM1; transmembrane protein 1; transport protein particle subunit TMEM1; TRAPP 130 kDa subunit; TRAPP subunit TMEM1; trappc10; TRS130; TRS30; wu:fc21a02
Common Name TRAPPC10
Gene Symbol TRAPPC10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RAVVYSNTREQSSEAALRIQSSDKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGMAEPHRKHKDKQRTGRCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTTHSLLSSGTRKYVQVCVQNLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.