missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211017

Invitrogen™ Human TRIM (aa 38-143) Control Fragment Recombinant Protein

Product Code. 30211017
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211017

Brand: Invitrogen™ RP102133

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51706 (PA5-51706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM (T cell receptor-interacting molecule), also known as TRAT1 (T cell receptor associated transmembrane adaptor 1) is a 30 kDa protein expressed by T cells as a cystein-linked homodimer. It associates with TCR-CD3-zeta-chain complex and becomes phosphorylated by Src-family kinases. TRIM is potentially involved in negative regulation of TCR-mediated signaling, but its role remains unclear.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6PIZ9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50852
Name Human TRIM (aa 38-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C030046M14Rik; HSPC062; pp29/30; T cell receptor associated transmembrane adaptor 1; T cell receptor interacting molecule; T-cell receptor interacting molecule; T-cell receptor-associated transmembrane adapter 1; T-cell receptor-interacting molecule; TCRIM; Trat1; TRIM
Common Name TRIM
Gene Symbol TRAT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.