missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRIM23 Control Fragment Recombinant Protein

Product Code. 30207552
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30207552 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30207552 Supplier Invitrogen™ Supplier No. RP96831

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58853 (PA5-58853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as an E3 ubiquitin-protein ligase. In the presence of the human cytomegalovirus (HCMV) protein UL144, participates in 'Lys-63'-linked auto-ubiquitination of TRAF6 resulting in the virally controlled activation of NF-kappa-B at early time of infection. The C-terminus can act as an allosteric activator of the cholera toxin catalytic subunit.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P36406
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 373
Name Human TRIM23 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330516O20Rik; ADP-ribosylation factor domain protein 1; ADP-ribosylation factor domain protein 1 64 kD; ADP-ribosylation factor domain protein 1, 64 kD; ADP-ribosylation factor domain protein 1, 64 kDa; ADP-ribosylation factor domain-containing protein 1; AI450195; ARD1; Ard-1; ARF domain protein 1; ARFD1; E3 ubiquitin-protein ligase TRIM23; GTP-binding protein ARD-1; nucleotide binding protein; RING finger protein 46; RING-type E3 ubiquitin transferase TRIM23; RNF46; TRIM23; tripartite motif containing 23; tripartite motif protein 23; tripartite motif protein TRIM23; tripartite motif-containing 23; tripartite motif-containing protein 23
Common Name TRIM23
Gene Symbol TRIM23
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.