missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRRAP (aa 2628-2713) Control Fragment Recombinant Protein

Product Code. 30206463
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206463

Brand: Invitrogen™ RP106537

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65866 (PA5-65866. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRRAP is an adapter protein, which is found in various multiprotein chromatin complexes with histone acetyltransferase activity (HAT), which gives a specific tag for epigenetic transcription activation. Component of the NuA4 histone acetyltransferase complex which is responsible for acetylation of nucleosomal histones H4 and H2A. TRRAP plays a central role in MYC transcription activation, and also participates in cell transformation by MYC is required for p53/TP53-, E2F1- and E2F4-mediated transcription activation and is also involved in transcription activation mediated by the adenovirus E1A, a viral oncoprotein that deregulates transcription of key genes. TRRAP probably acts by linking transcription factors such as E1A, MYC or E2F1 to HAT complexes such as STAGA thereby allowing transcription activation, however, it is probably not required in the steps following histone acetylation in processes of transcription activation. TRRAP may be required for the mitotic checkpoint and normal cell cycle progression. TRRAP is a component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y4A5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8295
Name Human TRRAP (aa 2628-2713) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 350/400 kDa PCAF-associated factor; AI481500; OTTHUMP00000197294; OTTHUMP00000197295; PAF350/400; PAF400; STAF40; Tra1; Tra1 homolog; transactivation/transformation-domain associated protein; transformation/transcription domain associated protein; transformation/transcription domain-associated protein; TR-AP; TRRAP
Common Name TRRAP
Gene Symbol TRRAP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.