missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210103

Invitrogen™ Human TTF1 (aa 397-495) Control Fragment Recombinant Protein

Product Code. 30210103
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210103

Brand: Invitrogen™ RP103201

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84221. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TTF1 is a transcription termination factor that is localized to the nucleolus and plays a critical role in ribosomal gene transcription. The protein mediates the termination of RNA polymerase I transcription by binding to Sal box terminator elements downstream of pre-rRNA coding regions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15361
Concentration 1.2 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 7270
Name Human TTF1 (aa 397-495) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AV245725; BCH; BHC; Homeobox protein NK-2 homolog A; homeobox protein Nkx-2.1; NK-2; NK2 homeobox 1; NK-2 homolog A; NKX2; NKX2.1; NKX2-1; NKX2A; NMTC1; RGD1565673; RNA polymerase I termination factor; RNA polymerase I transcription termination factor; T/EBP; TEBP; Thyroid nuclear factor 1; thyroid transcription factor 1; thyroid transcription factor 1-like; thyroid-specific enhancer-binding protein; TITF1; Transcription termination factor 1; transcription termination factor I; transcription termination factor, RNA polymerase I; TTF1; TTF-1; TTF-I
Common Name TTF1
Gene Symbol Ttf1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.