missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBE2E3 (aa 2-143) Control Fragment Recombinant Protein

Product Code. 30205963
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205963

Brand: Invitrogen™ RP102079

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51889 (PA5-51889. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ubiquitin (Ub) pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub and Ub-like molecules to specific protein substrates.The first step requires the ATP-dependent activation of the Ub C-terminusand the assembly of multi-Ub chains by the Ub-activating enzyme known as the E1 component. The Ub chain is then conjugated to the Ub-conjugating enzyme (E2) to generate an intermediate Ub-E2 complex. The Ub-ligase (E3) then catalyzes the transfer of Ub from E2 to the appropriate protein substrate. A wide range of enzymes facilitate in the proteolytic Ub pathway including UBE2E3, also designated UBCH9, which catalyzes the covalent attachment of ubiquitin to other proteins and is involved in the regulation of transepithelial sodium transport in renal cells. UBE2E3 may also be involved in cell growth arrest. The UBE2E3 protein shuttles between the cytoplasm and nucleus in a IPO11-dependent manner. It is ubiquitously expressed at low levels and is highly expressed in skeletal muscle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q969T4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10477
Name Human UBE2E3 (aa 2-143) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E2 ubiquitin-conjugating enzyme E3; Ubce4; UBCH9; UbcM2; UBE2E3; Ubiquitin carrier protein E3; ubiquitin conjugating enzyme E2 E3; ubiquitin conjugating enzyme E2E 3; ubiquitin-conjugating enzyme 4; ubiquitin-conjugating enzyme E2 E3; Ubiquitin-conjugating enzyme E2-23 kDa; ubiquitin-conjugating enzyme E2E 3; ubiquitin-conjugating enzyme E2E 3 (homologous to yeast UBC4/5); ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog; ubiquitin-protein ligase E3
Common Name UBE2E3
Gene Symbol UBE2E3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.