missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198656

Invitrogen™ Human UBE2V1 (aa 107-142) Control Fragment Recombinant Protein

Artikelnummer. 30198656
Click to view available options
Quantity:
100 μL
Packungsgröße:
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30198656

Marke: Invitrogen™ RP105625

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65767 (PA5-65767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q13404
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7335
Name Human UBE2V1 (aa 107-142) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610011J09Rik; AI256840; CIR1; CROC1; CROC-1; CROC1B; CROC-1 B; CROC-1 UBE2V; D7Bwg1382e; DJ1185N5.1.3; DNA-binding protein; KUA-UEV; P/OKcl0.19; TRAF6-regulated IKK activator 1 beta Uev1A; UBE2V; Ube2v1; ubiquitin conjugating enzyme E2 V1; ubiquitin conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme E2 variant 1; UEV1; UEV-1; UEV1A; UEV-1 CIR1
Common Name UBE2V1
Gene Symbol Ube2v1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt