missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201380

Invitrogen™ Human Ubiquilin 4 (aa 348-393) Control Fragment Recombinant Protein

Product Code. 30201380
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201380

Brand: Invitrogen™ RP104299

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63986 (PA5-63986. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ubiquitin-proteosome pathway of protein degradation is one of the mechanisms that ensure the proper level of cellular proteins. The ubiquitin-like (UbL) and ubiquitin-associated (UBA) domain containing protein family is thought to be involved in proteosomal degradation. One such protein is CIP75, also known as ubiquilin-4, interacts with a number of proteins such as Ataxin-1 and Connexin-43, resulting in an increased rate of turnover of these proteins. Overexpression CIP75 led to a significant reduction of Connexin-43 half-life, with the opposite being observed in siRNA knockdown experiments. CIP75 contains an N-terminal UbL domain which is thought to interact with proteins of the 26S proteosome complex and a C-terminal UBA domain which appears to mediate its interaction with Connexin-75. At least three isoforms of CIP75 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NRR5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56893
Name Human Ubiquilin 4 (aa 348-393) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A1u; A1Up; AI663987; Ataxin-1 interacting ubiquitin-like protein; ataxin-1 ubiquitin-like interacting protein; ataxin-1 ubiquitin-like-interacting protein A1U; C1orf6; CIP75; Connexin43-interacting protein of 75 kDa; RGD1308273; RP11-336K24.8; UBIN; ubiquilin 4; ubiquilin-4; UBQLN4
Common Name Ubiquilin 4
Gene Symbol UBQLN4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.