missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UGT1A6 (aa 39-122) Control Fragment Recombinant Protein

Product Code. 30212245
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212245

Brand: Invitrogen™ RP103807

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62911 (PA5-62911. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19224
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54578
Name Human UGT1A6 (aa 39-122) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A1; GNT1; HLUGP; HLUGP1; MGC29860; Phenol UDP-glucuronosyltransferase; phenol-metabolizing UDP-glucuronosyltransferase; P-nitrophenol specific; P-nitrophenol-specific UDPGT; UDP glucuronosyltransferase 1 family, polypeptide A6; UDP glucuronosyltransferase 1 family, polypeptide A6A; UDP glucuronosyltransferase 1A6; UDP glucuronosyltransferase family 1 member A6; UDP glycosyltransferase 1 family polypeptide A4; UDP glycosyltransferase 1 family, polypeptide A6; UDP-glucuronosyltransferase; UDP-glucuronosyltransferase 1 family polypeptide A6s; UDP-glucuronosyltransferase 1-6; UDP-glucuronosyltransferase 1A6; UDP-glucuronosyltransferase 1-F; Udpgt; UDPGT 1-6; UGP1A1; UGT1; UGT1*6; UGT1.6; UGT1-06; Ugt1a6; Ugt1a6a; UGT1A6S; UGT1A7; UGT1F; UGT-1 F
Common Name UGT1A6
Gene Symbol UGT1A6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.