missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ULK1 (aa 547-616) Control Fragment Recombinant Protein

Product Code. 30204235
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204235

Brand: Invitrogen™ RP107303

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ULK1 is a serine/threonine protein kinase that plays critical role during initial stages of autophagy which is a vital response to nutrient starvation. The conserved C-terminal domain (CTD) of ULK1 controls the regulatory function and localization of the protein. Knockdown of ULK1 inhibits the autophagic response as well as inhibiting rapamycin-induced autophagy consistent with a role downstream of mTOR. ULK1 forms a complex with FIP200 and ATG13 and this complex is essential for starvation-induced autophagy. Both FIP200 and ATG13 are critical for correct localization of ULK1 to the pre-autophagosome and stability of ULK1 protein. ULK1 is phosphorylated by the mTOR pathway in a nutrient starvation-regulated manner.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75385
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8408
Name Human ULK1 (aa 547-616) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias APG1; ATG 1; ATG1; ATG1 autophagy related 1 homolog; ATG1A; AU041434; Autophagy-related protein 1 homolog; C. elegans; EC:2.7.11.1; FLJ38455; hATG1; KIAA0722; mKIAA0722; Serine/threonine-protein kinase ULK1; serine/threonine-protein kinase Unc51.1; ULK 1; Ulk1; UNC 51; UNC51; unc-51 like autophagy activating kinase 1; unc-51 like kinase 1; Unc51.1; unc-51-like kinase 1
Common Name ULK1
Gene Symbol ULK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.