missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195124

Invitrogen™ Human ULK3 (aa 65-211) Control Fragment Recombinant Protein

Product Code. 30195124
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195124

Brand: Invitrogen™ RP89789

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59193 (PA5-59193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ULK3 or unc-51-like kinase 3 is a member of the serine/threonine kinase family that is involved in the SHH signaling pathway as a positive regulator of GLI proteins. ULK3 enhances endogenous and over-expressed GLI transcriptional activity in cultured cells and alters its subcellular localization. Furthermore, ULK3 phosphorylates GLI proteins in vitro. ULK3 is widely expressed and its expression is higher in a number of tissues where SHH signaling is known to be active, again suggesting that ULK3 is involved in the SHH pathway as a positive regulator of GLI proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6PHR2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25989
Name Human ULK3 (aa 65-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200015E14Rik; DKFZP434C131; EC:2.7.11.1; FLJ90566; Serine/threonine-protein kinase ULK3; ULK3; unc-51 like kinase 3; unc-51-like kinase 3
Common Name ULK3
Gene Symbol ULK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILKGIRHPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.