missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human WDR74 (aa 174-255) Control Fragment Recombinant Protein

Product Code. 30201771
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30201771 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30201771 Supplier Invitrogen™ Supplier No. RP102831

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83417 (PA5-83417. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The yeast nucleolar protein NOP7 is necessary for the maturation of 66S preribosomes and interacts with numerous other proteins. One such protein is an essential, conserved WD repeat protein, NOP seven-associated protein 1 (NSA1), that is also required for the yeast 66S ribosome assembly. NSA1 is also associated with the AAA ATPase Rix7, and release of NSA1 from a novel late nucleolar pre-60S requires the Rix7 function. NSA1 has also been found upregulated in mammalian cancer cells, suggesting it may also play a role in cell proliferation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6RFH5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54663
Name Human WDR74 (aa 174-255) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730436H21Rik; AA407588; NOP seven-associated protein 1; NSA1; WD repeat domain 74; WD repeat-containing protein 74; Wdr74
Common Name WDR74
Gene Symbol WDR74
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEID
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.