missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZBTB5 (aa 320-427) Control Fragment Recombinant Protein

Product Code. 30195118
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195118 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195118 Supplier Invitrogen™ Supplier No. RP93042

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54437 (PA5-54437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZBTB family of proteins is comprised of diverse zinc finger proteins that also contain a BTB (BR-C, ttk and bab) domain. ZBTB5 was identified though sequence analysis as a POZ domain Kruppel-like zinc finger (POK) protein. Further experiments indicated that it binds DNA and can directly repress transcription of the cell cycle arrest gene p21. ZBTB5 can also interact with co-repressor histone deacetylase complexes such as BCoR, NCoR, and SMRT via its POZ domain, resulting in deacetylation of histones Ac-H3 and Ac-H4 at the proximal promoter. ZBTB5 stimulates both cell proliferation and cell cycle progression, suggesting that it may act as a potential proto-oncogene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15062
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9925
Name Human ZBTB5 (aa 320-427) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5930421I10; 9430083K24Rik; AI646847; expressed in brain and neural tube; Kiaa0354; mKIAA0354; RP11-397D12.5; Transcription factor ZNF-POZ; ZBTB5; zinc finger and BTB domain containing 5; zinc finger and BTB domain-containing protein 5
Common Name ZBTB5
Gene Symbol ZBTB5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.