missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZC3H12C (aa 604-701) Control Fragment Recombinant Protein

Product Code. 30206049
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206049

Brand: Invitrogen™ RP104189

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58557 (PA5-58557. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H12C, also known as MCPIP3, is a member of a family of novel CCCH-zinc finger proteins that includes ZC3H12A, a protein that is thought to be involved in macrophage activation, host immunity and inflammatory diseases. Similar to ZC3H12A, ZC3H12C expression in macrophages is highly increased after treatment with lipopolysaccharide (LPS), suggesting it also may play a role in host immunity and inflammatory response.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9C0D7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85463
Name Human ZC3H12C (aa 604-701) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A230108E06; C230027N18Rik; Kiaa1726; MCP induced protein 3; MCP-induced protein 3; MCPIP3; mKIAA1726; Probable ribonuclease ZC3H12C; RGD1565078; ZC3H12C; Zinc finger CCCH domain-containing protein 12 C; zinc finger CCCH type containing 12 C; zinc finger CCCH-type containing 12 C
Common Name ZC3H12C
Gene Symbol ZC3H12C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENLKCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.