missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZC3HAV1 (aa 48-131) Control Fragment Recombinant Protein

Product Code. 30204288
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204288

Brand: Invitrogen™ RP106915

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111479 (PA5-111479. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc finger antiviral protein (ZC3HAV1) is a CCCH type zinc finger protein that induces an innate immunity to infections by retrovirus by preventing the accumulation of viral RNAs in the cytoplasm and recruits the RNA processing exosome to degrade target RNAs, thereby inhibiting virus replication. ZC3HAV1 is localized in the cytoplasm at steady state, but shuttles between nucleus and cytoplasm in a XPO1-dependent manner. ZAP is a direct target gene of IRF3 action in cellular antiviral responses.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z2W4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56829
Name Human ZC3HAV1 (aa 48-131) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200014N16Rik; 2900058M19Rik; 9130009D18Rik; 9830115L13Rik; ADP-ribosyltransferase diphtheria toxin-like 13; ARTD13; CCCH-type zinc finger antiviral protein (Zap); D6Bwg1452e; FLB6421; Inactive Poly [ADP-ribose] polymerase 13; PARP13; PRO1677; rZAP; ZAP; ZC3H2; Zc3hav1; ZC3HDC2; zinc finger antiviral protein; Zinc finger CCCH domain-containing protein 2; zinc finger CCCH type, antiviral 1; zinc finger CCCH-type antiviral protein 1; zinc finger CCCH-type containing, antiviral 1; zinc finger CCCH-type, antiviral 1
Common Name ZC3HAV1
Gene Symbol Zc3hav1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.