missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZEB2 (aa 731-854) Control Fragment Recombinant Protein

Product Code. 30200209
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200209

Brand: Invitrogen™ RP100743

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82094 (PA5-82094. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZEB2, initially identified as Smad interacting-protein 1, is normally located in the nucleus and functions as a DNA-binding transcriptional repressor that interacts with activated SMADs. Like the homologous ZEB1, ZEB2 inhibits the transcription of the E-cadherin gene and induces epithelial-mesenchymal transition, a genetic program controlling cell migration during embryonic development and wound healing, in vitro. ZEB2 can also protect cells from DNA damage-induced apoptosis, suggesting that its expression may contribute to tumor progression. Recent evidence has shown that ZEB2 is often observed in the cytoplasm in numerous cancer tissues, indicating that its localization may be regulated in normal and tumor tissues. Mutations in this gene are also associated with Hirschsprung disease/Mowat-Wilson syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60315
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9839
Name Human ZEB2 (aa 731-854) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9130203F04Rik; D130016B08Rik; HRIHFB2411; HSPC082; KIAA0569; SIP1; SIP-1; SMAD interacting protein 1; smad-interacting protein 1; SMADIP1; Zeb2; ZFH x 1 B; Zf x 1 b; Zfxh1b; zinc finger E-box binding homeobox 2; zinc finger E-box-binding homeobox 2; zinc finger homeobox 1 b; zinc finger homeobox protein 1 b
Common Name ZEB2
Gene Symbol Zeb2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.