missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208218

Invitrogen™ Human ZMYM4 (aa 157-240) Control Fragment Recombinant Protein

Product Code. 30208218
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30208218 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30208218 Supplier Invitrogen™ Supplier No. RP106574

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65899 (PA5-65899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains characterized by the unique role of zinc and have a wide variety of functions such as transcriptional activation or repression. The protein folding and the DNA binding ability are governed by the coordination of a zinc ion. It has been found to be overexpressed in human lung adenocarcinomas and squamous cell carcinomas, and the overexpression of a fragment of the 3'UTR of the ZMYM4 mRNA termed Cell Death Inhibiting RNA (CDIR) protects HeLa cells from IFN-gamma-induced apoptosis, suggesting that ZMYM4 may play a role in tumorigenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5VZL5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9202
Name Human ZMYM4 (aa 157-240) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330503C17Rik; AI480785; AW493829; CDIR; cell death inhibiting RNA; D630001M21; Kiaa0425; mKIAA0425; MYM; MYM type 4; Zfp262; zinc finger MYM-type containing 4; zinc finger MYM-type protein 4; Zinc finger protein 262; zinc finger, MYM-type 4; Zmym4; ZNF198L3; ZNF262
Common Name ZMYM4
Gene Symbol ZMYM4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVRENSKETFSGKEKNRDLTYEREKRLDKPHKDLDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSELG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.