missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZNF174 (aa 57-199) Control Fragment Recombinant Protein

Product Code. 30194880
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194880

Brand: Invitrogen™ RP102392

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82386 (PA5-82386. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF174, also known as ZSCAN8 or AW-1, is a transcriptional repressor that belongs to the Krueppel C2H2-type zinc-finger protein family. It is expressed in a number of different tissues, including small intestine, prostate, colon, spleen, pancreas, skeletal muscle, brain, heart, kidney and thymus, but it is most predominantly found in adult ovary and testis. ZNF174 specifically acts to repress the promoter activities of PDGF-B and TGF beta1. ZNF174 localizes to the nucleus and contains three C2H2-type zinc fingers at the C-terminus and one SCAN domain near the N-terminus. SCAN domains are found in a number of zinc-finger proteins and are characterized by a conserved region of 84 residues. The SCAN domain seemingly regulates the association of proteins containing SCAN domains into noncovalent complexes and may also function as an underlying mechanism in selective oligomerization of these proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15697
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7727
Name Human ZNF174 (aa 57-199) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW1; AW-1; zinc finger and SCAN domain-containing protein 8; Zinc finger protein 174; ZNF174; ZSCAN8
Common Name ZNF174
Gene Symbol ZNF174
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.