missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IGF2BP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35508-20ul
This item is not returnable.
View return policy
Description
IGF2BP1 Polyclonal antibody specifically detects IGF2BP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| IGF2BP1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 478-577 of human IGF2BP1 (NP_006537.3).,, Sequence:, GRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10642 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction