missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-12 R beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 559.00
Specifications
| Antigen | IL-12 R beta 1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18286222
|
Novus Biologicals
NBP2-57287 |
100 μL |
€ 559.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618326
|
Novus Biologicals
NBP2-57287-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-12 R beta 1 Polyclonal specifically detects IL-12 R beta 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| IL-12 R beta 1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor subunit beta-1, MGC34454 | |
| IL12RB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3594 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title