missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-17RE Antibody (46N7E3), DyLight 650, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-27367C
This item is not returnable.
View return policy
Description
IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| IL-17RE | |
| Monoclonal | |
| DyLight 650 | |
| Q8NFR9 | |
| IL17RE | |
| amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry (Paraffin) | |
| 46N7E3 | |
| Western Blot, Immunohistochemistry-Paraffin | |
| IL-17 receptor E, interleukin 17 receptor E | |
| Mouse | |
| Protein G purified | |
| RUO | |
| 132014 | |
| Store at 4C in the dark. | |
| IgG2b κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction