missing translation for 'onlineSavingsMsg'
Learn More

IL-17RE Antibody (46N8G7), Alexa Fluor™ 405, Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals NBP2-27366AF405

Product Code. 18145175

€ 506.00 / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot.

Specifications

Antigen	IL-17RE
Classification	Monoclonal
Conjugate	Alexa Fluor 405
Gene Alias	IL-17 receptor E, interleukin 17 receptor E
Host Species	Mouse
Purification Method	Protein G purified
Regulatory Status	RUO
Gene ID (Entrez)	132014
Content And Storage	Store at 4C in the dark.
Isotype	IgG1 κ

Applications	Western Blot
Clone	46N8G7
Dilution	Western Blot
Gene Symbols	IL17RE
Immunogen	amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Quantity	0.1 mL
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

IL-17RE Antibody (46N8G7), Alexa Fluor™ 405, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions