missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-28R alpha/IFN-lambda R1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 386.00 - € 549.00
Specifications
| Antigen | IL-28R alpha/IFN-lambda R1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18438130
|
Novus Biologicals
NBP1-84381-25ul |
25 μL |
€ 386.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18282558
|
Novus Biologicals
NBP1-84381 |
0.1 mL |
€ 549.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-28R alpha/IFN-lambda R1 Polyclonal specifically detects IL-28R alpha/IFN-lambda R1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| IL-28R alpha/IFN-lambda R1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2 | |
| IFNLR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8IU57 | |
| 163702 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title