missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-36 beta/IL-1F8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 572.00
Specifications
| Antigen | IL1F8 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18406520
|
Novus Biologicals
NBP1-83892-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18226017
|
Novus Biologicals
NBP1-83892 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-36 beta/IL-1F8 Polyclonal specifically detects IL-36 beta/IL-1F8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| IL1F8 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 27177 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| family of interleukin 1-eta, FIL1, FIL1 eta, FIL1-(ETA), FIL1H, IL-1 eta, IL1F8 (Canonical product IL-1F8a), IL-1F8 (FIL1-eta), IL-1F8IL1-ETA, IL-1H2MGC126880, IL1H2MGC126882, interleukin 1 family, member 8 (eta), interleukin 1, eta, Interleukin-1 eta, interleukin-1 family member 8, Interleukin-1 homolog 2, Interleukin-1 Superfamily e | |
| IL36B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title