missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 11586392

Invitrogen™ IL22RA2 Polyclonal Antibody

Product Code. 11586392
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
11586392 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 11586392 Supplier Invitrogen™ Supplier No. PA121359

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Goat Polyclonal Antibody

Recommended positive controls: Human spleen or tonsil..

IL22, a homolog of IL10, is secreted by T cells and binds to and signals through the class II cytokine receptor family (CRF) heterodimer IL22RA /IL10RB. IL22 induces the production of acute-phase reactants.
TRUSTED_SUSTAINABILITY

Specifications

Antigen IL22RA2
Applications ELISA, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/mL
Conjugate Unconjugated
Formulation PBS with 0.1% BSA and 0.1% sodium azide
Gene IL22RA2
Gene Accession No. Q7TNI4, Q80XF5, Q969J5
Gene Alias CRF2-10; CRF2-S1; CRF2X; Cytokine receptor class-II member 10; Cytokine receptor family 2 member 10; cytokine receptor family II soluble 1; cytokine receptor family type 2, soluble 1; IL-22 receptor subunit alpha-2; IL22BP; IL-22BP; Il22ra2; IL-22RA2; IL-22R-alpha-2; interleukin 22 receptor subunit alpha 2; interleukin 22 receptor, alpha 2; interleukin 22-binding protein; interleukin-22 receptor subunit alpha-2; Interleukin-22-binding protein; UNQ5793/PRO19598/PRO19822; ZcytoR16
Gene Symbols IL22RA2
Host Species Goat
Immunogen Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116379, 237310, 444986
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.