missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Importin alpha 2/KPNA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | Importin alpha 2/KPNA2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18162338
|
Novus Biologicals
NBP2-38482 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18660616
|
Novus Biologicals
NBP2-38482-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Importin alpha 2/KPNA2 Polyclonal specifically detects Importin alpha 2/KPNA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Importin alpha 2/KPNA2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, Immunology, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| importin alpha 1, importin-alpha-P1, IPOA1, karyopherin alpha 2 (RAG cohort 1, importin alpha 1), Karyopherin subunit alpha-2, pendulin, QIP2importin alpha 2, RAG cohort 1, RAG cohort protein 1, RCH1importin subunit alpha-2, SRP1, SRP1alpha, SRP1-alpha | |
| KPNA2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P52292 | |
| 3838 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title