missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ING5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 463.00 - € 782.00
Specifications
| Antigen | ING5 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18606168
|
Novus Biologicals
NBP3-05519-100ul |
100 μg |
€ 782.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610068
|
Novus Biologicals
NBP3-05519-25ul |
25 μg |
€ 463.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ING5 Polyclonal antibody specifically detects ING5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ING5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol | |
| 84289 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| inhibitor of growth family, member 5, inhibitor of growth protein 5, p28ING5FLJ23842 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title