missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin alpha 3/CD49c Antibody (29A3), Alexa Fluor™ 488, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP1-97692AF488
This item is not returnable.
View return policy
Description
Integrin alpha 3/CD49c Monoclonal specifically detects Integrin alpha 3/CD49c in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.
Specifications
| Integrin alpha 3/CD49c | |
| Monoclonal | |
| Alexa Fluor 488 | |
| 50mM Sodium Borate with 0.05% Sodium Azide | |
| ITGA3 | |
| Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. | |
| 0.1 mL | |
| Primary | |
| 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope. | |
| Store at 4C in the dark. | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen) | |
| 29A3 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen | |
| antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a | |
| Mouse | |
| Protein A or G purified | |
| RUO | |
| 3675 | |
| Human, Pig | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction