missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Integrin alpha 3B Antibody (PB36), DyLight 488, Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP1-97731G
This item is not returnable.
View return policy
Description
Integrin alpha 3B Monoclonal specifically detects Integrin alpha 3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.
Specifications
| Integrin alpha 3B | |
| Monoclonal | |
| DyLight 488 | |
| AA407068, CD49C, GAPB3, integrin alpha 3 | |
| Mouse | |
| Affinity Purified | |
| RUO | |
| 3675 | |
| Human | |
| IgG1 |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen) | |
| PB36 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen | |
| ITGA3 | |
| Clone PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha 3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. | |
| 0.1 mL | |
| Primary | |
| PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope. | |
| Store at 4C in the dark. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction