missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IRF5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | IRF5 |
|---|---|
| Dilution | Western Blot 1:100 - 1:250 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18402891
|
Novus Biologicals
NBP2-14128-25ul |
25ul |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18089967
|
Novus Biologicals
NBP2-14128 |
0.1 mL |
€ 593.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IRF5 Polyclonal specifically detects IRF5 in Human samples. It is validated for Western Blot.Specifications
| IRF5 | |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| IBD14, interferon regulatory factor 5, IRF-5, SLEB10 | |
| IRF5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:100 - 1:250 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3663 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title