missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
IRF7 Polyclonal antibody specifically detects IRF7 in Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | IRF7 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | HRP |
| Formulation | PBS |
| Gene Alias | interferon regulatory factor 7, interferon regulatory factor-7H, IRF-7, IRF7A, IRF-7H |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2).,, Sequence:, KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?