missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITPA Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33545-100ul
This item is not returnable.
View return policy
Description
ITPA Monoclonal antibody specifically detects ITPA in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| ITPA | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| C20orf37, dJ794I6.3, EC 3.6.1, EC 3.6.1.19, HLC14-06-P, Inosine triphosphatase, inosine triphosphatase (nucleoside triphosphate pyrophosphatase), inosine triphosphatase-A, inosine triphosphate pyrophosphatase, inosine triphosphate pyrophosphohydrolase, ITPase, My049 protein, nucleoside triphosphate diphosphatase, Putative oncogene protein hlc14-06-p | |
| A synthetic peptide corresponding to a sequence within amino acids 70-150 of human ITPA (Q9BY32).,, Sequence:, VEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFG | |
| 100 μL | |
| Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
| 3704 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?