missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ITPR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49294
This item is not returnable.
View return policy
Description
ITPR2 Polyclonal antibody specifically detects ITPR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ITPR2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| inositol 14,5-triphosphate receptor, type 2, inositol 14,5-trisphosphate receptor type 2, insP3R2, IP3 receptor, IP3 receptor isoform 2, IP3R 2, IP3R2, Type 2 inositol 14,5-trisphosphate receptor, Type 2 InsP3 receptor | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEEYEDGIERTC | |
| 0.1 mL | |
| Neuroscience | |
| 3709 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction