missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JMJD2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38192-20ul
This item is not returnable.
View return policy
Description
JMJD2B Polyclonal antibody specifically detects JMJD2B in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| JMJD2B | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| EC 1.14.11, FLJ44906, JHDM3B, JmjC domain-containing histone demethylation protein 3B, JMJD2BEC 1.14.11.-, jumonji domain containing 2B, Jumonji domain-containing protein 2B, KIAA0876lysine-specific demethylase 4B, lysine (K)-specific demethylase 4B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-365 of human JMJD2B (NP_055830.1).,, Sequence:, RAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELP | |
| 20 μL | |
| Chromatin Research, Epigenetics | |
| 23030 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction