missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JNK/JIP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49593-25ul
This item is not returnable.
View return policy
Description
JNK/JIP3 Polyclonal antibody specifically detects JNK/JIP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| JNK/JIP3 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C-jun-amino-terminal kinase interacting protein 3, C-Jun-amino-terminal kinase-interacting protein 3, DKFZp762N1113, homolog of Drosophila Sunday driver 2, JIP-3, JIP3FLJ00027, JNK MAP kinase scaffold protein 3, JNK/SAPK-associated protein-1, JNK/stress-activated protein kinase-associated protein 1, JNK-interacting protein 3, JSAP1, KIAA1066SYD2, mitogen-activated protein kinase 8 interacting protein 3, Mitogen-activated protein kinase 8-interacting protein 3, syd | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 23162 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction