missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Junctional Cadherin Complex Regulator Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69051
This item is not returnable.
View return policy
Description
Junctional Cadherin Complex Regulator Polyclonal antibody specifically detects Junctional Cadherin Complex Regulator in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Junctional Cadherin Complex Regulator | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C11orf63, chromosome 11 open reading frame 63 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 79864 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction