missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KA2/GRIK5/Glutamate Receptor KA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | KA2/GRIK5/Glutamate Receptor KA2 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18648216
|
Novus Biologicals
NBP2-68975-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667396
|
Novus Biologicals
NBP2-68975 |
100 μg |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
KA2/GRIK5/Glutamate Receptor KA2 Polyclonal antibody specifically detects KA2/GRIK5/Glutamate Receptor KA2 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| KA2/GRIK5/Glutamate Receptor KA2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2901 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit