missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kallikrein 4/Prostase/EMSP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | Kallikrein 4/Prostase/EMSP1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18479911
|
Novus Biologicals
NBP2-14171-25ul |
25ul |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18057729
|
Novus Biologicals
NBP2-14171 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Kallikrein 4/Prostase/EMSP1 Polyclonal specifically detects Kallikrein 4/Prostase/EMSP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Kallikrein 4/Prostase/EMSP1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| AI2A1, ARM1, EC 3.4.21, EC 3.4.21.-, EMSP, EMSP1MGC116827, Enamel matrix serine proteinase 1, kallikrein 4 (prostase, enamel matrix, prostate), kallikrein-4, Kallikrein-like protein 1, kallikrein-related peptidase 4, KLK-L1MGC116828, Prostase, PRSS17enamel matrix serine protease 1, PSTSandrogen-regulated message 1, Serine protease 17 | |
| KLK4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9622 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title