missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kallikrein 8/Neuropsin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05517-100ul
This item is not returnable.
View return policy
Description
Kallikrein 8/Neuropsin Polyclonal antibody specifically detects Kallikrein 8/Neuropsin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Kallikrein 8/Neuropsin | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 3.4.21, EC 3.4.21.118, hK8, HNP, kallikrein 8 (neuropsin/ovasin), kallikrein-related peptidase 8, KLK8, KLK8 protein type 1, KLK8 protein type 2, Neuropsin, neuropsin type 1, neuropsin type 2, NP, NRPN, Ovasin, PRSS19kallikrein-8, Serine protease 19, Serine protease TADG-14, TADG14neuropsin, Tumor-associated differentially expressed gene 14 protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG | |
| 100 μg | |
| Neuroscience | |
| 11202 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction