missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCC2/SLC12A5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49674
This item is not returnable.
View return policy
Description
KCC2/SLC12A5 Polyclonal antibody specifically detects KCC2/SLC12A5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| KCC2/SLC12A5 | |
| Polyclonal | |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Electroneutral potassium-chloride cotransporter 2, hKCC2, KCC2K-Cl cotransporter 2, KIAA1176erythroid K-Cl cotransporter 2, Neuronal K-Cl cotransporter, solute carrier family 12 (potassium/chloride transporter), member 5, solute carrier family 12 member 5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSC | |
| 0.1 mL | |
| Potassium Channels | |
| 57468 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu