missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCMF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 572.00
Specifications
| Antigen | KCMF1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18466090
|
Novus Biologicals
NBP1-84283-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18736673
|
Novus Biologicals
NBP1-84283 |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
KCMF1 Polyclonal specifically detects KCMF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| KCMF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DEBT91, DKFZp434L1021, EC 6.3.2, EC 6.3.2.-, FGF-induced in gastric cancer, FGF-induced ubiquitin-protein ligase in gastric cancers, FIGC, PCMFdifferentially expressed in branching tubulogenesis 91, Potassium channel modulatory factor, potassium channel modulatory factor 1, zinc finger, ZZ domain containing 1, ZZ-type zinc finger-containing protein 1, ZZZ1E3 ubiquitin-protein ligase KCMF1 | |
| KCMF1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 56888 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDIMPLDVALENLNLKESNKGNEPPPPPL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title