missing translation for 'onlineSavingsMsg'
Learn More
Learn More
KCNJ10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62724-25ul
This item is not returnable.
View return policy
Description
KCNJ10 Polyclonal antibody specifically detects KCNJ10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| KCNJ10 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| ATP-dependent inwardly rectifying potassium channel Kir4.1, ATP-sensitive inward rectifier potassium channel 10, BIRK-10, glial ATP-dependent inwardly rectifying potassium channel KIR4.1, Inward rectifier K(+) channel Kir1.2, inward rectifier K+ channel KIR1.2, KCNJ13-PEN, KIR1.2, Kir4.1, Potassium channel, inwardly rectifying subfamily J member 10, potassium inwardly-rectifying channel, subfamily J, member 10, SESAME | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV | |
| 25 μL | |
| Neuroscience | |
| 3766 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction